PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 267aa    MW: 29418.6 Da    PI: 9.4391
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58683594PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-32040PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-1496140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Lsa001625  96 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 140
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99789145IPR017930Myb domain
SuperFamilySSF466893.74E-1791146IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-1792143IPR006447Myb domain, plants
SMARTSM007171.8E-1093143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1195140IPR009057Homeodomain-like
PfamPF002491.4E-1196140IPR001005SANT/Myb domain
CDDcd001671.18E-996141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MSESHSMNGQ NSGDGGSGEI MLFGVRVKVD PMRKSVSMND LSQYVQIQPA THGSSSNSNN  60
NFDGSTAVAA DTGYASADDA VRNQSNGGRE RKRGVPWTEE EHKLFLLGLQ KVGKGDWRGI  120
SRNFVKTRTP TQVASHAQKY FLRRSNLNRR RRRSSLFDIT TDSVAAIPVE EQKDDEDNKS  180
QQISPLSGFP MAAFSPPSPL PLMENQMKTE AFCNGGQFNQ STRTNEKNSL SLSLNLSLSY  240
DNNRMVDSSA FQVIPPFNNG DRMISVG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169474.12e-75PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB1R1-like
SwissprotQ2V9B02e-70MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A103YC241e-110A0A103YC24_CYNCS; Homeodomain-like protein
STRINGSolyc06g071230.2.15e-71(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.21e-55MYB_related family protein